SCOPe 2.06: Domain d1fsoa1: 1fso A:67-203

Lineage for d1fsoa1 (1fso A:67-203)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)

8. Domain d1fsoa1: 1fso A:67-203 [60007]
   Other proteins in same PDB: d1fsoa2
   mutant

Details for d1fsoa1

PDB Entry: 1fso, 2 Å

PDB Description: crystal structure of truncated human rhogdi quadruple mutant

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1fsoa1:

Sequence; same for both SEQRES and ATOM records:

>d1fsoa1 b.1.18.8 (A:67-203) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyragvaidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnftikkdwk

Timeline for d1fsoa1:

• d1fsoa1 first appeared in SCOP 1.57, called d1fsoa_
  
• d1fsoa1 was called d1fsoa_ in SCOPe 2.05
  
• d1fsoa1 appears in SCOPe 2.07
  
• d1fsoa1 appears in the current release, SCOPe 2.08