Class a: All alpha proteins [46456] (151 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins) |
Protein Germination protein GerE [63488] (1 species) |
Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry) |
Domain d1fsef_: 1fse F: [60005] |
PDB Entry: 1fse (more details), 2.05 Å
SCOP Domain Sequences for d1fsef_:
Sequence, based on SEQRES records: (download)
>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis} plltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvellrm gelel
>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis} plltkrerevfellvqdkvrnhisnamqklgvkgrsqavvellrmgelel
Timeline for d1fsef_: