Lineage for d1fsef_ (1fse F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150473Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 150489Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins)
  6. 150490Protein Germination protein GerE [63488] (1 species)
  7. 150491Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry)
  8. 150497Domain d1fsef_: 1fse F: [60005]

Details for d1fsef_

PDB Entry: 1fse (more details), 2.05 Å

PDB Description: crystal structure of the bacillus subtilis regulatory protein gere

SCOP Domain Sequences for d1fsef_:

Sequence, based on SEQRES records: (download)

>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis}
plltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvellrm
gelel

Sequence, based on observed residues (ATOM records): (download)

>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis}
plltkrerevfellvqdkvrnhisnamqklgvkgrsqavvellrmgelel

SCOP Domain Coordinates for d1fsef_:

Click to download the PDB-style file with coordinates for d1fsef_.
(The format of our PDB-style files is described here.)

Timeline for d1fsef_: