Class b: All beta proteins [48724] (144 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein) |
Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species) delta subunit in mitochondria |
Species Escherichia coli [TaxId:562] [51347] (4 PDB entries) |
Domain d1fs0e2: 1fs0 E:1-86 [59998] Other proteins in same PDB: d1fs0e1, d1fs0g_ |
PDB Entry: 1fs0 (more details), 2.1 Å
SCOP Domain Sequences for d1fs0e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs0e2 b.93.1.1 (E:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli} amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee fiylsggilevqpgnvtvladtairg
Timeline for d1fs0e2: