SCOP 1.71: Domain d1fs0e1: 1fs0 E:87-134

Lineage for d1fs0e1 (1fs0 E:87-134)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (1 family)

5. Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (2 species)
   delta subunit in mitochondria
   this domain unfolds when bound to the gamma subunit

7. Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)

8. Domain d1fs0e1: 1fs0 E:87-134 [59997]
   Other proteins in same PDB: d1fs0e2, d1fs0g_

Details for d1fs0e1

PDB Entry: 1fs0, 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli

SCOP Domain Sequences for d1fs0e1:

Sequence, based on SEQRES records:

>d1fs0e1 a.2.10.1 (E:87-134) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvielt

Sequence, based on observed residues (ATOM records):

>d1fs0e1 a.2.10.1 (E:87-134) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli}
qdldearameakrkaeehdvdyaqasaelakaiaqlrvielt

Timeline for d1fs0e1:

• d1fs0e1 first appeared in SCOP 1.57
  
• d1fs0e1 appears in SCOP 1.69
  
• d1fs0e1 appears in SCOP 1.73
  
• d1fs0e1 appears in the current release, SCOPe 2.08