Lineage for d1fq1a_ (1fq1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599809Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1599810Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1599811Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 1599812Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 1599813Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 1599820Domain d1fq1a_: 1fq1 A: [59982]
    Other proteins in same PDB: d1fq1b_
    complexed with atp, mg

Details for d1fq1a_

PDB Entry: 1fq1 (more details), 3 Å

PDB Description: crystal structure of kinase associated phosphatase (kap) in complex with phospho-cdk2
PDB Compounds: (A:) cyclin-dependent kinase inhibitor 3

SCOPe Domain Sequences for d1fq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq1a_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}
edeqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfct
rgelskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihs
ygglgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
ssr

SCOPe Domain Coordinates for d1fq1a_:

Click to download the PDB-style file with coordinates for d1fq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq1a_: