SCOPe 2.02: Domain d1fpyh2: 1fpy H:101-468

Lineage for d1fpyh2 (1fpy H:101-468)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families)

5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)

8. Domain d1fpyh2: 1fpy H:101-468 [59967]
   Other proteins in same PDB: d1fpya1, d1fpyb1, d1fpyc1, d1fpyd1, d1fpye1, d1fpyf1, d1fpyg1, d1fpyh1, d1fpyi1, d1fpyj1, d1fpyk1, d1fpyl1
   complexed with adp, mn, ppq

Details for d1fpyh2

PDB Entry: 1fpy, 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

PDB Compounds: (H:) glutamine synthetase

SCOPe Domain Sequences for d1fpyh2:

Sequence; same for both SEQRES and ATOM records:

>d1fpyh2 d.128.1.1 (H:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Timeline for d1fpyh2:

• d1fpyh2 first appeared in SCOP 1.57
  
• d1fpyh2 appears in SCOPe 2.01
  
• d1fpyh2 appears in SCOPe 2.03
  
• d1fpyh2 appears in the current release, SCOPe 2.08