Lineage for d1fpya2 (1fpy A:101-468)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040112Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1040113Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1040114Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 1040115Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 1040171Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 1040220Domain d1fpya2: 1fpy A:101-468 [59953]
    Other proteins in same PDB: d1fpya1, d1fpyb1, d1fpyc1, d1fpyd1, d1fpye1, d1fpyf1, d1fpyg1, d1fpyh1, d1fpyi1, d1fpyj1, d1fpyk1, d1fpyl1
    complexed with adp, mn, ppq

Details for d1fpya2

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d1fpya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpya2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOPe Domain Coordinates for d1fpya2:

Click to download the PDB-style file with coordinates for d1fpya2.
(The format of our PDB-style files is described here.)

Timeline for d1fpya2: