Lineage for d1fpya1 (1fpy A:1-100)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599288Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 599289Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 599290Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 599340Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 599367Domain d1fpya1: 1fpy A:1-100 [59952]
    Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2

Details for d1fpya1

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpya1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1fpya1:

Click to download the PDB-style file with coordinates for d1fpya1.
(The format of our PDB-style files is described here.)

Timeline for d1fpya1: