SCOPe 2.07: Domain d1fpxa1: 1fpx A:8-108

Lineage for d1fpxa1 (1fpx A:8-108)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Isoflavone O-methyltransferase [63478] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (3 PDB entries)

8. Domain d1fpxa1: 1fpx A:8-108 [59950]
   Other proteins in same PDB: d1fpxa2
   complexed with sam

Details for d1fpxa1

PDB Entry: 1fpx, 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase

PDB Compounds: (A:) isoflavone-o-methyltransferase

SCOPe Domain Sequences for d1fpxa1:

Sequence; same for both SEQRES and ATOM records:

>d1fpxa1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
rkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqvpssk
ignvrrlmrylahngffeiitkeeesyaltvasellvrgsd

Timeline for d1fpxa1:

• d1fpxa1 first appeared in SCOP 1.57
  
• d1fpxa1 appears in SCOPe 2.06
  
• d1fpxa1 does not appear in SCOPe 2.08