SCOPe 2.05: Domain d1fp2a2: 1fp2 A:109-352

Lineage for d1fp2a2 (1fp2 A:109-352)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein Isoflavone O-methyltransferase [64114] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [64115] (2 PDB entries)

8. Domain d1fp2a2: 1fp2 A:109-352 [59942]
   Other proteins in same PDB: d1fp2a1
   complexed with hmo, sah

Details for d1fp2a2

PDB Entry: 1fp2, 1.4 Å

PDB Description: crystal structure analysis of isoflavone o-methyltransferase

PDB Compounds: (A:) isoflavone o-methyltransferase

SCOPe Domain Sequences for d1fp2a2:

Sequence; same for both SEQRES and ATOM records:

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndam
asdsklinlalrdcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenls
gsnnltyvggdmftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiid
mvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgflsli
eiyp

Timeline for d1fp2a2:

• d1fp2a2 first appeared in SCOP 1.57
  
• d1fp2a2 appears in SCOPe 2.04
  
• d1fp2a2 appears in SCOPe 2.06
  
• d1fp2a2 appears in the current release, SCOPe 2.08