Lineage for d1fnql1 (1fnq L:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141805Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 141806Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 141807Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries)
  8. 141851Domain d1fnql1: 1fnq L: [59918]
    Other proteins in same PDB: d1fnqh1

Details for d1fnql1

PDB Entry: 1fnq (more details), 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> glu from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1fnql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnql1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtedhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1fnql1:

Click to download the PDB-style file with coordinates for d1fnql1.
(The format of our PDB-style files is described here.)

Timeline for d1fnql1: