Lineage for d1fnql_ (1fnq L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027284Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
    Uniprot P02954
  8. 3027309Domain d1fnql_: 1fnq L: [59918]
    Other proteins in same PDB: d1fnqh1, d1fnqh2, d1fnqm_
    complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1fnql_

PDB Entry: 1fnq (more details), 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> glu from the photosynthetic purple bacterium rhodobacter sphaeroides
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1fnql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnql_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtedhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1fnql_:

Click to download the PDB-style file with coordinates for d1fnql_.
(The format of our PDB-style files is described here.)

Timeline for d1fnql_: