SCOP 1.75: Domain d1fnqh1: 1fnq H:36-249

Lineage for d1fnqh1 (1fnq H:36-249)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
   Uniprot P11846

8. Domain d1fnqh1: 1fnq H:36-249 [59916]
   Other proteins in same PDB: d1fnqh2, d1fnql_, d1fnqm_
   complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1fnqh1

PDB Entry: 1fnq, 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> glu from the photosynthetic purple bacterium rhodobacter sphaeroides

PDB Compounds: (H:) reaction center protein h chain

SCOP Domain Sequences for d1fnqh1:

Sequence; same for both SEQRES and ATOM records:

>d1fnqh1 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrk

Timeline for d1fnqh1:

• d1fnqh1 first appeared in SCOP 1.57
  
• d1fnqh1 appears in SCOP 1.73
  
• d1fnqh1 appears in SCOPe 2.01
  
• d1fnqh1 appears in the current release, SCOPe 2.08