Lineage for d1fnpm1 (1fnp M:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201555Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 201556Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 201557Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)
  8. 201605Domain d1fnpm1: 1fnp M: [59915]
    Other proteins in same PDB: d1fnph1

Details for d1fnpm1

PDB Entry: 1fnp (more details), 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> phe from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1fnpm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnpm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
eyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf
sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff
mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs
hldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadr
gtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
g

SCOP Domain Coordinates for d1fnpm1:

Click to download the PDB-style file with coordinates for d1fnpm1.
(The format of our PDB-style files is described here.)

Timeline for d1fnpm1: