Lineage for d1fngd2 (1fng D:4-92)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326974Protein Class II MHC beta chain, N-terminal domain [88819] (13 species)
  7. 327036Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (7 PDB entries)
  8. 327038Domain d1fngd2: 1fng D:4-92 [59911]
    Other proteins in same PDB: d1fnga1, d1fnga2, d1fngb1, d1fngc1, d1fngc2, d1fngd1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1fngd2

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fngd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fngd2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1fngd2:

Click to download the PDB-style file with coordinates for d1fngd2.
(The format of our PDB-style files is described here.)

Timeline for d1fngd2: