Lineage for d1fngc2 (1fng C:1-81)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501441Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 501443Domain d1fngc2: 1fng C:1-81 [59909]
    Other proteins in same PDB: d1fnga1, d1fngb1, d1fngb2, d1fngc1, d1fngd1, d1fngd2

Details for d1fngc2

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fngc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fngc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1fngc2:

Click to download the PDB-style file with coordinates for d1fngc2.
(The format of our PDB-style files is described here.)

Timeline for d1fngc2: