Lineage for d1fngc1 (1fng C:82-182)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288963Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 288965Domain d1fngc1: 1fng C:82-182 [59908]
    Other proteins in same PDB: d1fnga2, d1fngb1, d1fngb2, d1fngc2, d1fngd1, d1fngd2
    complexed with nag

Details for d1fngc1

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fngc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fngc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOP Domain Coordinates for d1fngc1:

Click to download the PDB-style file with coordinates for d1fngc1.
(The format of our PDB-style files is described here.)

Timeline for d1fngc1: