![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (5 PDB entries) |
![]() | Domain d1fngc1: 1fng C:82-182 [59908] Other proteins in same PDB: d1fnga2, d1fngb2, d1fngc2, d1fngd2 |
PDB Entry: 1fng (more details), 1.9 Å
SCOP Domain Sequences for d1fngc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fngc1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
Timeline for d1fngc1: