Lineage for d1fngb2 (1fng B:4-92)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190561Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)
  8. 190563Domain d1fngb2: 1fng B:4-92 [59907]
    Other proteins in same PDB: d1fnga1, d1fngb1, d1fngc1, d1fngd1

Details for d1fngb2

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (B:)

SCOP Domain Sequences for d1fngb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fngb2 d.19.1.1 (B:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1fngb2:

Click to download the PDB-style file with coordinates for d1fngb2.
(The format of our PDB-style files is described here.)

Timeline for d1fngb2: