SCOP 1.59: Domain d1fnec1: 1fne C:82-182

Lineage for d1fnec1 (1fne C:82-182)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (5 PDB entries)

8. Domain d1fnec1: 1fne C:82-182 [59900]
   Other proteins in same PDB: d1fnea2, d1fneb2, d1fnec2, d1fned2

Details for d1fnec1

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fnec1:

Sequence; same for both SEQRES and ATOM records:

>d1fnec1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

Timeline for d1fnec1:

• d1fnec1 first appeared in SCOP 1.57
  
• d1fnec1 appears in SCOP 1.61
  
• d1fnec1 appears in the current release, SCOPe 2.08