Lineage for d1fneb2 (1fne B:4-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409749Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 409752Domain d1fneb2: 1fne B:4-92 [59899]
    Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb1, d1fnec1, d1fnec2, d1fned1

Details for d1fneb2

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fneb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fneb2 d.19.1.1 (B:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1fneb2:

Click to download the PDB-style file with coordinates for d1fneb2.
(The format of our PDB-style files is described here.)

Timeline for d1fneb2: