SCOP 1.63: Domain d1fneb2: 1fne B:4-92

Lineage for d1fneb2 (1fne B:4-92)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)

8. Domain d1fneb2: 1fne B:4-92 [59899]
   Other proteins in same PDB: d1fnea1, d1fneb1, d1fnec1, d1fned1

Details for d1fneb2

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fneb2:

Sequence; same for both SEQRES and ATOM records:

>d1fneb2 d.19.1.1 (B:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

Timeline for d1fneb2:

• d1fneb2 first appeared in SCOP 1.57
  
• d1fneb2 appears in SCOP 1.61
  
• d1fneb2 appears in SCOP 1.65
  
• d1fneb2 appears in the current release, SCOPe 2.08