SCOPe 2.01: Domain d1fnea2: 1fne A:1-81

Lineage for d1fnea2 (1fne A:1-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)

8. Domain d1fnea2: 1fne A:1-81 [59897]
   Other proteins in same PDB: d1fnea1, d1fneb1, d1fneb2, d1fnec1, d1fned1, d1fned2
   complexed with nag

Details for d1fnea2

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (A:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnea2:

Sequence; same for both SEQRES and ATOM records:

>d1fnea2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

Timeline for d1fnea2:

• d1fnea2 first appeared in SCOP 1.57
  
• d1fnea2 appears in SCOP 1.75
  
• d1fnea2 appears in SCOPe 2.02
  
• d1fnea2 appears in the current release, SCOPe 2.08