SCOPe 2.08: Domain d1fn7a1: 1fn7 A:136-325

Lineage for d1fn7a1 (1fn7 A:136-325)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)

8. Domain d1fn7a1: 1fn7 A:136-325 [59892]
   Other proteins in same PDB: d1fn7a2
   protein/DNA complex; complexed with ca

Details for d1fn7a1

PDB Entry: 1fn7, 2.6 Å

PDB Description: coupling of damage recognition and catalysis by a human base-excision dna repair protein

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase 1

SCOPe Domain Sequences for d1fn7a1:

Sequence; same for both SEQRES and ATOM records:

>d1fn7a1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1fn7a1:

• d1fn7a1 first appeared in SCOP 1.57
  
• d1fn7a1 appears in SCOPe 2.07