SCOP 1.63: Domain d1fn4d2: 1fn4 D:107-208

Lineage for d1fn4d2 (1fn4 D:107-208)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 198 against actylcholine receptor, (rat) [63659] (1 PDB entry)

8. Domain d1fn4d2: 1fn4 D:107-208 [59891]
   Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4c1, d1fn4d1

Details for d1fn4d2

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d2:

Sequence; same for both SEQRES and ATOM records:

>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin (constant domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc

Timeline for d1fn4d2:

• d1fn4d2 first appeared in SCOP 1.57
  
• d1fn4d2 appears in SCOP 1.61
  
• d1fn4d2 appears in SCOP 1.65
  
• d1fn4d2 appears in the current release, SCOPe 2.08