Lineage for d1fn4d2 (1fn4 D:107-208)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53491Species Fab 198 against actylcholine receptor, (rat) [63659] (1 PDB entry)
  8. 53495Domain d1fn4d2: 1fn4 D:107-208 [59891]
    Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4c1, d1fn4d1

Details for d1fn4d2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin (constant domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1fn4d2:

Click to download the PDB-style file with coordinates for d1fn4d2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4d2: