Lineage for d1fn4d1 (1fn4 D:1-106)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451578Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 451607Domain d1fn4d1: 1fn4 D:1-106 [59890]
    Other proteins in same PDB: d1fn4a1, d1fn4a2, d1fn4b2, d1fn4c1, d1fn4c2, d1fn4d2
    part of Fab 198 against acetylcholine receptor

Details for d1fn4d1

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4d1 b.1.1.1 (D:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpg

SCOP Domain Coordinates for d1fn4d1:

Click to download the PDB-style file with coordinates for d1fn4d1.
(The format of our PDB-style files is described here.)

Timeline for d1fn4d1: