Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries) |
Domain d1fn4c2: 1fn4 C:108-211 [59889] Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2 part of Fab 198 against acetylcholine receptor |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4c2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d1fn4c2: