SCOP 1.63: Domain d1fn4c1: 1fn4 C:1-107

Lineage for d1fn4c1 (1fn4 C:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 198 against actylcholine receptor, (rat) [63648] (1 PDB entry)

8. Domain d1fn4c1: 1fn4 C:1-107 [59888]
   Other proteins in same PDB: d1fn4a2, d1fn4b2, d1fn4c2, d1fn4d2

Details for d1fn4c1

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4c1:

Sequence; same for both SEQRES and ATOM records:

>d1fn4c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkr

Timeline for d1fn4c1:

• d1fn4c1 first appeared in SCOP 1.57
  
• d1fn4c1 appears in SCOP 1.61
  
• d1fn4c1 appears in SCOP 1.65
  
• d1fn4c1 appears in the current release, SCOPe 2.08