Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 198 against actylcholine receptor, (rat) [63648] (1 PDB entry) |
Domain d1fn4c1: 1fn4 C:1-107 [59888] Other proteins in same PDB: d1fn4a2, d1fn4b2, d1fn4c2, d1fn4d2 |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)} dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkr
Timeline for d1fn4c1: