SCOPe 2.05: Domain d1fn4a2: 1fn4 A:108-211

Lineage for d1fn4a2 (1fn4 A:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries)

8. Domain d1fn4a2: 1fn4 A:108-211 [59885]
   Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2
   part of Fab 198 against acetylcholine receptor

Details for d1fn4a2

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

PDB Compounds: (A:) monoclonal antibody against acetylcholine receptor

SCOPe Domain Sequences for d1fn4a2:

Sequence; same for both SEQRES and ATOM records:

>d1fn4a2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd
stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

Timeline for d1fn4a2:

• d1fn4a2 first appeared in SCOP 1.57
  
• d1fn4a2 appears in SCOPe 2.04
  
• d1fn4a2 appears in SCOPe 2.06
  
• d1fn4a2 appears in the current release, SCOPe 2.08