Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries) |
Domain d1fn4a2: 1fn4 A:108-211 [59885] Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2 part of Fab 198 against acetylcholine receptor |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOPe Domain Sequences for d1fn4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4a2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d1fn4a2: