Lineage for d1fn4a2 (1fn4 A:108-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656543Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries)
  8. 656554Domain d1fn4a2: 1fn4 A:108-211 [59885]
    Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2

Details for d1fn4a2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
PDB Compounds: (A:) monoclonal antibody against acetylcholine receptor

SCOP Domain Sequences for d1fn4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4a2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd
stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOP Domain Coordinates for d1fn4a2:

Click to download the PDB-style file with coordinates for d1fn4a2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4a2: