Lineage for d1fmlb_ (1fml B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123994Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2124059Protein Retinol dehydratase [64015] (1 species)
  7. 2124060Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)
  8. 2124064Domain d1fmlb_: 1fml B: [59882]
    complexed with a3p, ca, rtl

Details for d1fmlb_

PDB Entry: 1fml (more details), 2.75 Å

PDB Description: crystal structure of retinol dehydratase in a complex with retinol and pap
PDB Compounds: (B:) retinol dehydratase

SCOPe Domain Sequences for d1fmlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmlb_ c.37.1.5 (B:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp

SCOPe Domain Coordinates for d1fmlb_:

Click to download the PDB-style file with coordinates for d1fmlb_.
(The format of our PDB-style files is described here.)

Timeline for d1fmlb_: