Lineage for d1fmlb_ (1fml B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins) 
Protein Retinol dehydratase [64015] (1 species) Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries) 
Domain d1fmlb_: 1fml B: [59882]
Details for d1fmlb_
PDB Entry: 1fml (more details), 2.75 Å
PDB Description: crystal structure of retinol dehydratase in a complex with retinol and pap
SCOP Domain Sequences for d1fmlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmlb_ c.37.1.5 (B:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda)}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp
SCOP Domain Coordinates for d1fmlb_:
Click to download the PDB-style file with coordinates for d1fmlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmlb_:
- d1fmlb_ first appeared in SCOP 1.57
- d1fmlb_ appears in SCOP 1.61
- d1fmlb_ appears in the current release, SCOPe 2.08
View in 3D
