Lineage for d1fmla_ (1fml A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179379Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
  6. 179402Protein Retinol dehydratase [64015] (1 species)
  7. 179403Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)
  8. 179406Domain d1fmla_: 1fml A: [59881]

Details for d1fmla_

PDB Entry: 1fml (more details), 2.75 Å

PDB Description: crystal structure of retinol dehydratase in a complex with retinol and pap

SCOP Domain Sequences for d1fmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmla_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda)}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp

SCOP Domain Coordinates for d1fmla_:

Click to download the PDB-style file with coordinates for d1fmla_.
(The format of our PDB-style files is described here.)

Timeline for d1fmla_: