SCOPe 2.08: Domain d1fmla_: 1fml A:

Lineage for d1fmla_ (1fml A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein Retinol dehydratase [64015] (1 species)

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)

8. Domain d1fmla_: 1fml A: [59881]
   complexed with a3p, ca, rtl
   has additional insertions and/or extensions that are not grouped together

Details for d1fmla_

PDB Entry: 1fml, 2.75 Å

PDB Description: crystal structure of retinol dehydratase in a complex with retinol and pap

PDB Compounds: (A:) retinol dehydratase

SCOPe Domain Sequences for d1fmla_:

Sequence; same for both SEQRES and ATOM records:

>d1fmla_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp

Timeline for d1fmla_:

• d1fmla_ first appeared in SCOP 1.57
  
• d1fmla_ appears in SCOPe 2.07