Lineage for d1fmjb_ (1fmj B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695512Family c.37.1.5: PAPS sulfotransferase [52575] (13 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 695568Protein Retinol dehydratase [64015] (1 species)
  7. 695569Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)
  8. 695571Domain d1fmjb_: 1fmj B: [59880]
    complexed with a3p, ca, hg, rtl

Details for d1fmjb_

PDB Entry: 1fmj (more details), 2 Å

PDB Description: crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
PDB Compounds: (B:) retinol dehydratase

SCOP Domain Sequences for d1fmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmjb_ c.37.1.5 (B:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
yedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigiladg
ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm

SCOP Domain Coordinates for d1fmjb_:

Click to download the PDB-style file with coordinates for d1fmjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fmjb_: