Lineage for d1fmja_ (1fmj A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163476Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 1163534Protein Retinol dehydratase [64015] (1 species)
  7. 1163535Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)
  8. 1163536Domain d1fmja_: 1fmj A: [59879]
    complexed with a3p, ca, hg, rtl

Details for d1fmja_

PDB Entry: 1fmj (more details), 2 Å

PDB Description: crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
PDB Compounds: (A:) retinol dehydratase

SCOPe Domain Sequences for d1fmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
yedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigiladg
ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm

SCOPe Domain Coordinates for d1fmja_:

Click to download the PDB-style file with coordinates for d1fmja_.
(The format of our PDB-style files is described here.)

Timeline for d1fmja_: