SCOPe 2.06: Domain d1fjja1: 1fjj A:1-158

Lineage for d1fjja1 (1fjj A:1-158)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
   automatically mapped to Pfam PF01161

6. Protein Hypothetical protein YbhB [63702] (1 species)

7. Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)

8. Domain d1fjja1: 1fjj A:1-158 [59852]
   Other proteins in same PDB: d1fjja2
   complexed with epe

Details for d1fjja1

PDB Entry: 1fjj, 1.66 Å

PDB Description: crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family

PDB Compounds: (A:) hypothetical 17.1 kda protein in modc-bioa intergenic region

SCOPe Domain Sequences for d1fjja1:

Sequence; same for both SEQRES and ATOM records:

>d1fjja1 b.17.1.2 (A:1-158) Hypothetical protein YbhB {Escherichia coli [TaxId: 562]}
mklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgsg
wwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryiftv
haldieridvdegasgamvgfnvhfhslasasitamfs

Timeline for d1fjja1:

• d1fjja1 first appeared in SCOP 1.57, called d1fjja_
  
• d1fjja1 was called d1fjja_ in SCOPe 2.05
  
• d1fjja1 appears in SCOPe 2.07
  
• d1fjja1 appears in the current release, SCOPe 2.08