Lineage for d1fi4a1 (1fi4 A:3-190)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716877Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)
  6. 716918Protein Mevalonate 5-diphosphate decarboxylase [64219] (1 species)
  7. 716919Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64220] (1 PDB entry)
  8. 716920Domain d1fi4a1: 1fi4 A:3-190 [59847]
    Other proteins in same PDB: d1fi4a2
    mutant

Details for d1fi4a1

PDB Entry: 1fi4 (more details), 2.27 Å

PDB Description: the x-ray crystal structure of mevalonate 5-diphosphate decarboxylase at 2.3 angstrom resolution.
PDB Compounds: (A:) mevalonate 5-diphosphate decarboxylase

SCOP Domain Sequences for d1fi4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi4a1 d.14.1.5 (A:3-190) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vytasvtapvniatlkywgkrdtklnlptnssisvtlsqddlrtltsaatapeferdtlw
lngephsidnertqnclrdlrqlrkemeskdaslptlsqwklhivsennfptaaglassa
agfaalvsaiaklyqlpqstseisriarkgsgsacrslfggyvawemgkaedghdsmavq
iadssdwp

SCOP Domain Coordinates for d1fi4a1:

Click to download the PDB-style file with coordinates for d1fi4a1.
(The format of our PDB-style files is described here.)

Timeline for d1fi4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fi4a2