Lineage for d1fi3a_ (1fi3 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277143Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 277191Protein Cytochrome c551 [46660] (4 species)
  7. 277209Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)
  8. 277212Domain d1fi3a_: 1fi3 A: [59846]
    complexed with hec; mutant

Details for d1fi3a_

PDB Entry: 1fi3 (more details)

PDB Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551

SCOP Domain Sequences for d1fi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
hppnpvteeeakilaewvlslk

SCOP Domain Coordinates for d1fi3a_:

Click to download the PDB-style file with coordinates for d1fi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi3a_: