Lineage for d1fhjd_ (1fhj D:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148559Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 148773Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry)
  8. 148775Domain d1fhjd_: 1fhj D: [59840]
    Other proteins in same PDB: d1fhja_, d1fhjc_

Details for d1fhjd_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus)}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1fhjd_:

Click to download the PDB-style file with coordinates for d1fhjd_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjd_: