Lineage for d1fhjc_ (1fhj C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148338Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 148545Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63440] (1 PDB entry)
  8. 148547Domain d1fhjc_: 1fhj C: [59839]
    Other proteins in same PDB: d1fhjb_, d1fhjd_

Details for d1fhjc_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.

SCOP Domain Sequences for d1fhjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Maned wolf (Chrysocyon brachyurus)}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkfftavstvltskyr

SCOP Domain Coordinates for d1fhjc_:

Click to download the PDB-style file with coordinates for d1fhjc_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjc_: