Lineage for d1fhha_ (1fhh A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90495Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 90565Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 90566Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 90567Protein Rubredoxin [57804] (6 species)
  7. 90576Species Clostridium pasteurianum [TaxId:1501] [57808] (12 PDB entries)
  8. 90585Domain d1fhha_: 1fhh A: [59836]

Details for d1fhha_

PDB Entry: 1fhh (more details), 1.5 Å

PDB Description: x-ray crystal structure of oxidized rubredoxin

SCOP Domain Sequences for d1fhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhha_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOP Domain Coordinates for d1fhha_:

Click to download the PDB-style file with coordinates for d1fhha_.
(The format of our PDB-style files is described here.)

Timeline for d1fhha_: