SCOP 1.57: Domain d1fgcc_: 1fgc C:

Lineage for d1fgcc_ (1fgc C:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d1fgcc_: 1fgc C: [59822]

Details for d1fgcc_

PDB Entry: 1fgc, 1.9 Å

PDB Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes

SCOP Domain Sequences for d1fgcc_:

Sequence; same for both SEQRES and ATOM records:

>d1fgcc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d1fgcc_:

• d1fgcc_ is new in SCOP 1.57
  
• d1fgcc_ appears in SCOP 1.59
  
• d1fgcc_ appears in the current release, SCOPe 2.08