Lineage for d1fejd_ (1fej D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61254Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 61270Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 61271Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)
  8. 61287Domain d1fejd_: 1fej D: [59799]

Details for d1fejd_

PDB Entry: 1fej (more details), 1.78 Å

PDB Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes

SCOP Domain Sequences for d1fejd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fejd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf

SCOP Domain Coordinates for d1fejd_:

Click to download the PDB-style file with coordinates for d1fejd_.
(The format of our PDB-style files is described here.)

Timeline for d1fejd_: