SCOP 1.65: Domain d1fe8m1: 1fe8 M:1-107

Lineage for d1fe8m1 (1fe8 M:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1fe8m1: 1fe8 M:1-107 [59794]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2

Details for d1fe8m1

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8m1:

Sequence; same for both SEQRES and ATOM records:

>d1fe8m1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevk

Timeline for d1fe8m1:

• d1fe8m1 first appeared in SCOP 1.57
  
• d1fe8m1 appears in SCOP 1.63
  
• d1fe8m1 appears in SCOP 1.67
  
• d1fe8m1 appears in the current release, SCOPe 2.08