Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab RU5, (mouse), kappa L chain [63640] (1 PDB entry) |
Domain d1fe8m1: 1fe8 M:1-107 [59794] Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2 |
PDB Entry: 1fe8 (more details), 2.03 Å
SCOP Domain Sequences for d1fe8m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe8m1 b.1.1.1 (M:1-107) Immunoglobulin (variable domains of L and H chains) {Fab RU5, (mouse), kappa L chain} diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevk
Timeline for d1fe8m1: