Lineage for d1fe8l2 (1fe8 L:108-211)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104374Species Fab RU5, (mouse), kappa L chain [63653] (1 PDB entry)
  8. 104378Domain d1fe8l2: 1fe8 L:108-211 [59793]
    Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8i1, d1fe8j1, d1fe8l1, d1fe8m1, d1fe8n1

Details for d1fe8l2

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
radaapttsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1fe8l2:

Click to download the PDB-style file with coordinates for d1fe8l2.
(The format of our PDB-style files is described here.)

Timeline for d1fe8l2: