Lineage for d1fe8l1 (1fe8 L:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52532Species Fab RU5, (mouse), kappa L chain [63640] (1 PDB entry)
  8. 52536Domain d1fe8l1: 1fe8 L:1-107 [59792]
    Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2

Details for d1fe8l1

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevk

SCOP Domain Coordinates for d1fe8l1:

Click to download the PDB-style file with coordinates for d1fe8l1.
(The format of our PDB-style files is described here.)

Timeline for d1fe8l1: