SCOP 1.59: Domain d1fe8j1: 1fe8 J:1-115

Lineage for d1fe8j1 (1fe8 J:1-115)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab RU5, (mouse), kappa L chain [63640] (1 PDB entry)

8. Domain d1fe8j1: 1fe8 J:1-115 [59790]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2

Details for d1fe8j1

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8j1:

Sequence; same for both SEQRES and ATOM records:

>d1fe8j1 b.1.1.1 (J:1-115) Immunoglobulin (variable domains of L and H chains) {Fab RU5, (mouse), kappa L chain}
dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvss

Timeline for d1fe8j1:

• d1fe8j1 first appeared in SCOP 1.57
  
• d1fe8j1 appears in SCOP 1.61
  
• d1fe8j1 appears in the current release, SCOPe 2.08